PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0009s0174.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family G2-like
Protein Properties Length: 385aa    MW: 41460 Da    PI: 7.3681
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0009s0174.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1049.1e-33194249156
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                          k+r++W+peLH+rF++a++qLGG+++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  Kalax.0009s0174.1.p 194 KQRRCWSPELHRRFIHALQQLGGPHVATPKQIKELMKVDGLTNDEVKSHLQKYRLH 249
                          79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.88E-18191252IPR009057Homeodomain-like
PROSITE profilePS5129415.314191251IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-28191252IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-27194249IPR006447Myb domain, plants
PfamPF002496.1E-8196247IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 385 aa     Download sequence    Send to blast
MDYAEKMQKC SEYVEALEVE RRKIQVFQRE LPLCLELVSQ AIDACRQQLS SASPPHAAAV  60
GASHECFHVR QQSECSEQTS SHGPVLEEFI PIKLAASCSS EDVGEEEEDE SGEKSGDKSG  120
KKSDWLRSVQ LWNQSPDPAP VCEVKKNGGA FRPFNKEKAV VVAEMVDKPA SSTTVKSRKE  180
ESAKEKESGQ TQRKQRRCWS PELHRRFIHA LQQLGGPHVA TPKQIKELMK VDGLTNDEVK  240
SHLQKYRLHM RRPSATMASN ANAQGPQFVV VGGIWVPPPE YAAPAMTPAA TTSSGDPPDA  300
DNGKREARTP SNGVYAPVAT VGTPFARPAS RTQNSNQKVQ SGSHCEDDNG SHSAHGGARA  360
HSGSPASSSS THTTATATAS PASS*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00160DAPTransfer from AT1G25550Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003631224.11e-129PREDICTED: probable transcription factor GLK2
TrEMBLA0A061EBX61e-125A0A061EBX6_THECC; Myb-like transcription factor family protein, putative isoform 1
TrEMBLA0A0J8B7X91e-125A0A0J8B7X9_BETVU; Uncharacterized protein
STRINGVIT_01s0011g03110.t011e-125(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25550.14e-91G2-like family protein